DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and Mep1b

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:260 Identity:84/260 - (32%)
Similarity:129/260 - (49%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WALTLVVIFLASSCSA---------APTTQNRIETDPELTAGYIEGDMVPSPEGRNGLRNETFRW 59
            |.|......|.|...|         ....|:..:.:.:|.....|||:.....|||.:..:.:||
  Rat     8 WFLVFATFLLVSGLPAPEKFVKDIDGGIDQDIFDINEDLGLDLFEGDIKLEASGRNSIIGDNYRW 72

  Fly    60 PNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNR 124
            |:.|. |.:...::...:..||.........:|:.|| ..:.:|.|::| .:..||:|.||    
  Rat    73 PHTIP-YVLEDSLEMNAKGVILNAFERYRLKTCIDFK-PWSGEENYISV-FKGSGCWSSVG---- 130

  Fly   125 VQQLNL----QTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNK 185
                |:    |..::.|.|.|:.|:.|||||||||:|:||..:||||:.|..:.|..|.|.|||.
  Rat   131 ----NIHAGKQELSIGTNCDRIATVQHEFLHALGFWHEQSRADRDDYITIVWDRILSGKEHNFNI 191

  Fly   186 YDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            |::...:....||||:||:||:..||....|.||:......|:::|||:..:..|:.|||.:|.|
  Rat   192 YNDSVSDSLNVPYDYTSVMHYSKTAFQNGTESTIITKISDFEDVIGQRMDFSDYDLLKLNQLYSC 256

  Fly   251  250
              Rat   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 71/197 (36%)
ZnMc_astacin_like 61..248 CDD:239807 66/190 (35%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 78/236 (33%)
Astacin 70..258 CDD:279708 71/198 (36%)
MAM 266..430 CDD:279023
MAM 266..428 CDD:99706
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.