DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and Mep1a

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_037275.1 Gene:Mep1a / 25684 RGDID:3080 Length:748 Species:Rattus norvegicus


Alignment Length:269 Identity:86/269 - (31%)
Similarity:132/269 - (49%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WALTLVVIFLASSCSAAPTTQNRIET-----DPEL------------TAG--YIEGDMVPSPEGR 49
            |.|.:.::.|:.|...|..:...:.|     |.::            .||  ..:||:: .|..|
  Rat     3 WTLPVCLLSLSFSAHIAAVSIQHLSTGHDHDDVDVGEQQKDISEINSAAGLNLFQGDIL-LPRTR 66

  Fly    50 NGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGG 114
            |.||:.:.||...|.|...: ::|...:..||....:....||:.||....:..|.  :..:..|
  Rat    67 NALRDPSSRWKPPIPYILAD-NLDLNAKGAILNAFEMFRLKSCVDFKPYEGESSYI--IFQQFSG 128

  Fly   115 CYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGT 179
            |:|.||.::..|.:     ::..||.....|.||.||||||:|:||..:|||||.|....|....
  Rat   129 CWSMVGDQHVGQNI-----SIGEGCDYKAIIEHEILHALGFFHEQSRTDRDDYVNIWWNEIMTDY 188

  Fly   180 EGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQEGAEELMGQRLQMTQSDINK 243
            |.|||.||::|:.|...||||.|::||..::|:||..: ||.........::||||..:.:|:.:
  Rat   189 EHNFNTYDDKTITDLNTPYDYESLMHYGPFSFNKNETIPTITTKIPEFNAIIGQRLDFSATDLTR 253

  Fly   244 LNVMYKCPR 252
            ||.||.|.|
  Rat   254 LNRMYNCTR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 68/193 (35%)
ZnMc_astacin_like 61..248 CDD:239807 64/187 (34%)
Mep1aNP_037275.1 ZnMc 32..260 CDD:294052 78/236 (33%)
Astacin 75..261 CDD:279708 68/193 (35%)
MAM 270..433 CDD:279023
MAM 270..432 CDD:99706
MATH 432..596 CDD:295307
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 641..668
EGF 676..710 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46226
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.