DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and Tll1

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_033416.2 Gene:Tll1 / 21892 MGIID:106923 Length:1013 Species:Mus musculus


Alignment Length:196 Identity:65/196 - (33%)
Similarity:104/196 - (53%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRN 123
            ||..::.|.|..:.....|....:.:|..|:.:|:.|.| .:|:|.|:..|....||.||||.|.
Mouse   157 WPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTE-RSDEESYIVFTYRPCGCCSYVGRRG 220

  Fly   124 RVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDN 188
            .    ..|..::...|.:.|.:|||..|.:||:|:.:..:||::|.|..|||..|.|.||.|.:.
Mouse   221 N----GPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEP 281

  Fly   189 ETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQE--GAEELMGQRLQMTQSDINKLNVMYKC 250
            ..|...||.||:.|::||....||:...: ||:|.::  |....:|||.::::.||.:...:|:|
Mouse   282 GEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRC 346

  Fly   251 P 251
            |
Mouse   347 P 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 63/194 (32%)
ZnMc_astacin_like 61..248 CDD:239807 60/189 (32%)
Tll1NP_033416.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..150
ZnMc_BMP1_TLD 148..347 CDD:239808 63/194 (32%)
Astacin 155..348 CDD:279708 65/196 (33%)
CUB 349..458 CDD:278839
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.