DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and Tll1

DIOPT Version :10

Sequence 1:NP_609757.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_033416.2 Gene:Tll1 / 21892 MGIID:106923 Length:1013 Species:Mus musculus


Alignment Length:196 Identity:65/196 - (33%)
Similarity:104/196 - (53%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRN 123
            ||..::.|.|..:.....|....:.:|..|:.:|:.|.| .:|:|.|:..|....||.||||.|.
Mouse   157 WPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTE-RSDEESYIVFTYRPCGCCSYVGRRG 220

  Fly   124 RVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDN 188
            .    ..|..::...|.:.|.:|||..|.:||:|:.:..:||::|.|..|||..|.|.||.|.:.
Mouse   221 N----GPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEP 281

  Fly   189 ETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQE--GAEELMGQRLQMTQSDINKLNVMYKC 250
            ..|...||.||:.|::||....||:...: ||:|.::  |....:|||.::::.||.:...:|:|
Mouse   282 GEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRC 346

  Fly   251 P 251
            |
Mouse   347 P 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_609757.1 ZnMc_astacin_like 61..248 CDD:239807 60/189 (32%)
Tll1NP_033416.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..150
ZnMc_BMP1_TLD 148..347 CDD:239808 63/194 (32%)
CUB 349..458 CDD:395345
CUB 462..571 CDD:395345
FXa_inhibition 582..614 CDD:464251
CUB 618..727 CDD:395345
FXa_inhibition 734..769 CDD:464251
CUB 774..883 CDD:395345
CUB 887..1000 CDD:395345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.