Sequence 1: | NP_001285959.1 | Gene: | CG15254 / 34915 | FlyBaseID: | FBgn0028949 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033416.2 | Gene: | Tll1 / 21892 | MGIID: | 106923 | Length: | 1013 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 65/196 - (33%) |
---|---|---|---|
Similarity: | 104/196 - (53%) | Gaps: | 8/196 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRN 123
Fly 124 RVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDN 188
Fly 189 ETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQE--GAEELMGQRLQMTQSDINKLNVMYKC 250
Fly 251 P 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15254 | NP_001285959.1 | Astacin | 58..251 | CDD:279708 | 63/194 (32%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 60/189 (32%) | ||
Tll1 | NP_033416.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 124..150 | ||
ZnMc_BMP1_TLD | 148..347 | CDD:239808 | 63/194 (32%) | ||
Astacin | 155..348 | CDD:279708 | 65/196 (33%) | ||
CUB | 349..458 | CDD:278839 | |||
CUB | 462..571 | CDD:278839 | |||
FXa_inhibition | 582..614 | CDD:291342 | |||
CUB | 618..727 | CDD:278839 | |||
FXa_inhibition | 734..769 | CDD:291342 | |||
CUB | 774..883 | CDD:278839 | |||
CUB | 887..1000 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |