| Sequence 1: | NP_001285959.1 | Gene: | CG15254 / 34915 | FlyBaseID: | FBgn0028949 | Length: | 254 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006512741.1 | Gene: | Adgrg6 / 215798 | MGIID: | 1916151 | Length: | 1258 | Species: | Mus musculus |
| Alignment Length: | 235 | Identity: | 37/235 - (15%) |
|---|---|---|---|
| Similarity: | 68/235 - (28%) | Gaps: | 109/235 - (46%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 GRNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEA 112
Fly 113 GGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQ-----------------QS 160
Fly 161 TWNRD---DYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKN-------- 214
Fly 215 ----------------------GEMT-IVPLQEGAEELMG 231 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15254 | NP_001285959.1 | Astacin | 58..251 | CDD:279708 | 32/225 (14%) |
| ZnMc_astacin_like | 61..248 | CDD:239807 | 32/222 (14%) | ||
| Adgrg6 | XP_006512741.1 | CUB | 48..156 | CDD:238001 | |
| LamG | 188..347 | CDD:389952 | |||
| HRM | 543..588 | CDD:382965 | |||
| GPS | 809..854 | CDD:366827 | |||
| 7tm_GPCRs | 869..1137 | CDD:391938 | 20/134 (15%) | ||
| TM helix 1 | 871..896 | CDD:341315 | |||
| TM helix 2 | 906..928 | CDD:341315 | |||
| TM helix 3 | 939..966 | CDD:341315 | |||
| TM helix 4 | 981..997 | CDD:341315 | |||
| TM helix 5 | 1026..1049 | CDD:341315 | |||
| TM helix 6 | 1072..1097 | CDD:341315 | 7/61 (11%) | ||
| TM helix 7 | 1101..1126 | CDD:341315 | 1/24 (4%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||