DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-16

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_505889.2 Gene:nas-16 / 186922 WormBaseID:WBGene00003535 Length:337 Species:Caenorhabditis elegans


Alignment Length:185 Identity:54/185 - (29%)
Similarity:88/185 - (47%) Gaps:39/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IRIIEQSSCLVFKEATT--DQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIV 146
            :..|...:|:.|:|..|  .:..:|:.|.    |.||||..|.||::....:     |.|.|:.|
 Worm     5 MNFISSQTCVTFEENCTISTRIKFVDSTF----CASYVGMINSVQEIYFPDW-----CMRFGSAV 60

  Fly   147 HEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYG----------EPYDYS 201
            ||.:||||..|..:.::||:::.:           |.|| |:|...::.          .||:|.
 Worm    61 HELMHALGVLHTHARFDRDNFLNV-----------NLNK-DDEDDSNFEIVSPPFSINVVPYEYG 113

  Fly   202 SVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMY--KCPRQV 254
            |.|||||   ..:|..:::|.|......:|.| ::|..|:..:|..|  |||.::
 Worm   114 STLHYTA---DVSGTNSLLPKQMEYYRTLGNR-RVTFYDMLTINTAYNCKCPSEL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 52/180 (29%)
ZnMc_astacin_like 61..248 CDD:239807 50/175 (29%)
nas-16NP_505889.2 ZnMc 4..156 CDD:294052 50/175 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.