DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-2

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_503678.3 Gene:nas-2 / 186345 WormBaseID:WBGene00003521 Length:272 Species:Caenorhabditis elegans


Alignment Length:264 Identity:70/264 - (26%)
Similarity:111/264 - (42%) Gaps:66/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QNRIETDPEL-TAGYIEGDMV-------PSPEGR-------------NGLRNETFRWPNRIVYYY 67
            :||..|:|.| ..|..|.:::       ||..|.             :.|:..::.|||..|.|.
 Worm     4 KNRRPTEPVLKRRGISENNILTKLPTFEPSKYGHINIPLRKKRGIALHPLQWASYLWPNAEVPYD 68

  Fly    68 INRDIDTEHRNHILRGIRIIEQSSCLVFK-EATTDQEY-----YVNVTSEAGGCYSYVGYRNR-- 124
            |.....:..::.||..:...:..:|:.|: .|.||:.|     |.||..    |:||:|.::.  
 Worm    69 IATHYTSTEKSIILSAMEAFKNVTCVRFRPRAATDKHYLQINKYFNVER----CFSYIGRQSSRT 129

  Fly   125 ---VQQLNLQT-YALDTGCFR---LGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGN 182
               ..:.|::| ..||..|.|   .|.::||.:|.|||||:....:||..:      :......|
 Worm   130 LFGTPEGNVETRMRLDPACLRGNGRGIVMHELMHILGFYHEHQRDDRDRRI------VGSAVHYN 188

  Fly   183 FNKYDN-ETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNV 246
            |..|.. :|:  |...||.:|::||.   |..      :|.|        :|...:.|||..:|.
 Worm   189 FKIYRRAKTL--YMGAYDANSIMHYN---FQN------LPWQ--------RRDHFSTSDIININT 234

  Fly   247 MYKC 250
            .|||
 Worm   235 FYKC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 59/209 (28%)
ZnMc_astacin_like 61..248 CDD:239807 54/202 (27%)
nas-2NP_503678.3 Astacin 58..240 CDD:279708 59/210 (28%)
ZnMc 62..236 CDD:294052 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.