DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-1

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_499768.2 Gene:nas-1 / 185811 WormBaseID:WBGene00003520 Length:270 Species:Caenorhabditis elegans


Alignment Length:239 Identity:73/239 - (30%)
Similarity:113/239 - (47%) Gaps:26/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PTTQNRIETDPELTAGYIEGDM-VPSPEGRNG----LRNETFRWPNRIVYYYINRDIDTEHRNHI 80
            |||..|       ....:..|| :|....:.|    :..|..:|||..|.|.::....:..|..:
 Worm    44 PTTNTR-------RVRSLYHDMRIPFQRFKRGGGVAVAAEKDKWPNGRVPYILSAAYTSAQRAVL 101

  Fly    81 LRGIRIIEQSSCLVF-KEATTDQEYYVNVTSEAGGCY---SYVGYRNRVQQLNLQTYALDTGCFR 141
            .|......:.:|:.| .::..|::|.  |..:..|||   |.||.|.:|        :|...|..
 Worm   102 ARAFDTYAKRTCIRFVPKSPADKDYI--VIQKLDGCYADFSRVGGRQQV--------SLADECID 156

  Fly   142 LGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHY 206
            ..||:||.:|.:||.|:....:||.||.|..:|:.:|...:|:|..|..:..|||.|||||::||
 Worm   157 YATIIHELMHVIGFIHEHQREDRDSYVSILYQNVIQGANTDFDKLSNLGLSYYGEHYDYSSIMHY 221

  Fly   207 TAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            .|...|:||:.||.........:||:....:.||:.::|..|||
 Worm   222 EANEGSRNGKNTIEAKNSHFTAIMGKASDFSTSDLRRVNRAYKC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 64/197 (32%)
ZnMc_astacin_like 61..248 CDD:239807 59/190 (31%)
nas-1NP_499768.2 Astacin 79..266 CDD:279708 64/197 (32%)
ZnMc_astacin_like 82..263 CDD:239807 59/190 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.