DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-14

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_502533.2 Gene:nas-14 / 184247 WormBaseID:WBGene00003533 Length:503 Species:Caenorhabditis elegans


Alignment Length:264 Identity:88/264 - (33%)
Similarity:128/264 - (48%) Gaps:39/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 APTTQNRIETDPEL----TAGYIEGDMVPSPEGRNG-----LR-------NETFR---------- 58
            |.|...:..||.|:    .:...|||::..||....     ||       :|.||          
 Worm    54 AETAPVKKPTDAEIESMQNSLLFEGDIMGVPEIEKSDILKRLRDDPLLDEDEIFRKPFHSALNLV 118

  Fly    59 ------WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNV-TSEAGGCY 116
                  ||...|.|.:...:..:.|..|.:.....:..:|:.|...|.|...|:.| .:.|.||.
 Worm   119 TYPDKLWPEGQVPYMLEEGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCS 183

  Fly   117 SYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEG 181
            ||||.....|.::|:.    ..||..|.|.||.:|||||:|:.|..:|||:|.|.|:||..|...
 Worm   184 SYVGRAGGNQTVSLEV----DKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMR 244

  Fly   182 NFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNV 246
            ||.||..:.::..|.||||.||:||...|||:||:.||:|....|:  :|||.::::.|..|:|.
 Worm   245 NFEKYPRKIIDSLGMPYDYESVMHYHKLAFSRNGKPTIIPKDNEAD--VGQRYKLSEMDSKKVNK 307

  Fly   247 MYKC 250
            :|:|
 Worm   308 LYQC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 74/210 (35%)
ZnMc_astacin_like 61..248 CDD:239807 69/187 (37%)
nas-14NP_502533.2 Astacin 123..313 CDD:279708 73/195 (37%)
ZnMc_astacin_like 128..309 CDD:239807 69/186 (37%)
ShKT 380..414 CDD:214586
ShK 468..503 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3510
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.