DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-8

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_501114.2 Gene:nas-8 / 183207 WormBaseID:WBGene00003527 Length:403 Species:Caenorhabditis elegans


Alignment Length:204 Identity:71/204 - (34%)
Similarity:107/204 - (52%) Gaps:10/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEAT-TDQEY-YVNVTSE 111
            |||:...|.:|||..:.|.|:...:...|..:.|..:.....:|:.|...| .|.:| |:   .:
 Worm   111 RNGVITGTRKWPNGRIPYVISNQYNDRERAVLARSFQAYHDKTCVRFVPRTAVDNDYLYI---GK 172

  Fly   112 AGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENIT 176
            ..||||.||.....|:|     :||.||.:..|.:||.:|::||||:...|:||:::.|...||.
 Worm   173 IDGCYSDVGRAGGRQEL-----SLDNGCLQYDTAIHELMHSVGFYHEHERWDRDEHITILWHNID 232

  Fly   177 EGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDI 241
            ......|.|.|......||:.|||.|::||.:.||||||..|:|..|.....::|..:..:..||
 Worm   233 REAYDQFGKVDLAESSYYGQLYDYYSIMHYDSLAFSKNGFETMVAKQSEMTAVIGAAIDFSPIDI 297

  Fly   242 NKLNVMYKC 250
            .|:|:||:|
 Worm   298 LKMNLMYQC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 67/195 (34%)
ZnMc_astacin_like 61..248 CDD:239807 62/188 (33%)
nas-8NP_501114.2 Astacin 119..308 CDD:279708 67/196 (34%)
ZnMc_astacin_like 123..304 CDD:239807 62/188 (33%)
ShK 337..372 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.