DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-4

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001254938.1 Gene:nas-4 / 182259 WormBaseID:WBGene00003523 Length:365 Species:Caenorhabditis elegans


Alignment Length:238 Identity:82/238 - (34%)
Similarity:133/238 - (55%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIETDPELTAGYIEGD-MVPSPE---------GRNGLRNETFRWPNRIVYYYINRDIDTEHRNHI 80
            :::.||.: ..|.||| ::.||:         |||.::....||||..:.|.::....:..|:.|
 Worm    62 KVKDDPTI-GNYSEGDILLESPKKFVEENNKLGRNAIKQIYRRWPNNEIPYTLSSQYGSYARSVI 125

  Fly    81 LRGIRIIEQSSCLVF--KEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLG 143
            ...:......:|:.|  ::.:...:|......|  ||||.||...     ..|..:||:||.::|
 Worm   126 ANAMNEYHTKTCVKFVARDPSKHHDYLWIHPDE--GCYSLVGKTG-----GKQPVSLDSGCIQVG 183

  Fly   144 TIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTA 208
            |||||.:||:||:|:||..:||.|:.:..:|:..|.:..|.||:...:....|||||:|::||..
 Worm   184 TIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGP 248

  Fly   209 YAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKCP 251
            ||||.:|:.|:||.:.|:|. ||||::.:..|:.|:|.:|.||
 Worm   249 YAFSGSGKKTLVPKKSGSER-MGQRVKFSDIDVRKINKLYNCP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 69/194 (36%)
ZnMc_astacin_like 61..248 CDD:239807 65/188 (35%)
nas-4NP_001254938.1 Astacin 102..290 CDD:279708 69/195 (35%)
ZnMc_astacin_like 106..287 CDD:239807 65/188 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.