DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-6

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:273 Identity:82/273 - (30%)
Similarity:137/273 - (50%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TWALTLVVIFLASSCSAAPTTQNRIETDPELT------AGYIEGD-------MVPSPEGR---NG 51
            |:.|...|:....|.....:....|..|..:|      :|..:||       ::..|||.   |.
 Worm     9 TYCLVSTVVRSQPSADVFRSFAGYIPEDHRVTHHEWQNSGKFQGDIDGVDPNLLKLPEGPVLFNA 73

  Fly    52 LRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIE-------QSSCLVF--KEATTDQEYYVN 107
            |:|:...|...::.|    ::||....:   .|:|:|       :::|:.|  :|..||   |:|
 Worm    74 LKNKQLTWEGGVIPY----EMDTAFSPN---EIKILEKAFDSYRRTTCIRFEKREGQTD---YLN 128

  Fly   108 VTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAE 172
            :. :..||||.||.....|::     :|..|||....||||.:|::||:|:.|..:|||:::|..
 Worm   129 IV-KGYGCYSQVGRTGGKQEI-----SLGRGCFFHEIIVHELMHSVGFWHEHSRADRDDHIKINW 187

  Fly   173 ENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMT 237
            :||..|.:..|:|......:..||.|||.|::||.:.|||:||..||..::.|..:::|..:.::
 Worm   188 DNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDSTAFSRNGRNTIETVENGFTQVIGTAMDLS 252

  Fly   238 QSDINKLNVMYKC 250
            ..||.|:|.:|.|
 Worm   253 PLDIVKINKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 66/202 (33%)
ZnMc_astacin_like 61..248 CDD:239807 63/195 (32%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 65/200 (33%)
ZnMc_astacin_like 83..263 CDD:239807 63/195 (32%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_112325
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.