DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-10

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001257126.1 Gene:nas-10 / 181287 WormBaseID:WBGene00003529 Length:540 Species:Caenorhabditis elegans


Alignment Length:260 Identity:77/260 - (29%)
Similarity:119/260 - (45%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 APTTQNRIETDPELT---AGYIEGDM-------VPSPEGRNGLRNETF-------RWPNRI-VYY 66
            ||......:.|..||   |.::..::       :|.|......|...|       :||:.. :.|
 Worm   249 APEDNGVFDKDLLLTETQANFMLNELGKGGEGAIPMPGSAKAKRASIFFEQNLIQKWPSTSPIPY 313

  Fly    67 YINRDIDTEHRNHILRGIRIIEQSSCLVFKE-ATTDQEYYVN---VTSEAGGCYSYVGYRNRVQQ 127
            ..:..:|...:|.:...|..|||.:|:.||. |:..:..::|   |.|.:....||:|   ||:.
 Worm   314 TFDSSLDNLDQNDVRGAISEIEQKTCIRFKYFASPPKGNHINYQKVNSPSFCGLSYIG---RVEP 375

  Fly   128 LNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVE 192
            .|....:...|..| |..|||.:||||..||....:||.::::...||      |..:||...|.
 Worm   376 ANPVYLSFQCGNGR-GIAVHETMHALGVNHQHLRMDRDKHIKVDWSNI------NPQQYDAFVVA 433

  Fly   193 D------YGEPYDYSSVLHYTAYAFSKN-GEMTIVPL--QEGAEELMGQRLQMTQSDINKLNVMY 248
            |      ||..|.|.|::||.||..:.| .:.|::||  |:....|:|||.:|:.:|:..||.||
 Worm   434 DSKLYTTYGVKYAYDSIMHYNAYTGAVNIAKPTMIPLVNQQANIGLLGQRAKMSNADVEILNKMY 498

  Fly   249  248
             Worm   499  498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 67/205 (33%)
ZnMc_astacin_like 61..248 CDD:239807 63/200 (32%)
nas-10NP_001257126.1 Astacin 303..501 CDD:396122 67/206 (33%)
ShK 503..540 CDD:396228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.