DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-37

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001024413.1 Gene:nas-37 / 181208 WormBaseID:WBGene00003553 Length:765 Species:Caenorhabditis elegans


Alignment Length:216 Identity:73/216 - (33%)
Similarity:107/216 - (49%) Gaps:25/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PEGRNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQE---YYVN 107
            |:.||       .|||..:.|......:| .|..|...||.:||:.|..|||...|::   ||  
 Worm   118 PDPRN-------FWPNLTISYEFYGGEET-WRQLIRSAIRHVEQNVCFKFKENGGDRDGLRYY-- 172

  Fly   108 VTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAE 172
               ...||:|.||   ||.  ..|..::..||..||.:.||.|||||.:|:||..:||:::.|..
 Worm   173 ---RGNGCWSNVG---RVG--GRQLVSIGYGCDSLGIVSHETLHALGLWHEQSRDDRDNFISIVA 229

  Fly   173 ENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGA-EELMGQRLQM 236
            :.||.||||||.|......::.|:|||..||:||.|.:|:.:.....:..::.. :..:|||..:
 Worm   230 DKITRGTEGNFAKRTAANSDNLGQPYDLGSVMHYGAKSFAYDWSSDTIKTRDWRYQNTIGQRDGL 294

  Fly   237 TQSDINKLNVMY---KCPRQV 254
            :..|...:|..|   .|.|.:
 Worm   295 SFKDAKMINTRYCSNVCQRSL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 68/199 (34%)
ZnMc_astacin_like 61..248 CDD:239807 65/190 (34%)
nas-37NP_001024413.1 Astacin 122..309 CDD:279708 69/204 (34%)
ZnMc_astacin_like 126..306 CDD:239807 65/190 (34%)
CUB 370..455 CDD:214483
TSP1 579..626 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.