DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-9

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_741532.1 Gene:nas-9 / 178875 WormBaseID:WBGene00003528 Length:546 Species:Caenorhabditis elegans


Alignment Length:231 Identity:67/231 - (29%)
Similarity:108/231 - (46%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ELTAGYIEGDMVPSPEGRNGL---RNETFRWPN-RIVYYYINRDIDTEHRNHILRGIRIIEQSSC 92
            ::.||...|..||    |:|:   .:...:|.. :.:.|.::..::...:..|...:..|..::|
 Worm   287 DVGAGGGGGGRVP----RSGVFFQESAVQKWDIWKPIQYTLDDSLEESDKKDIRDALHEISINTC 347

  Fly    93 LVFKEATTDQEYYVN---VTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALG 154
            ::|:...|.:.|::|   |.|......||||..:....:.|.....|    ..|..:||.:||||
 Worm   348 ILFRYNATPKGYHLNYMKVDSTTFCGLSYVGRTDPANPIYLSFQCGD----NRGVAMHETMHALG 408

  Fly   155 FYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKN-GEMT 218
            ..||....:||.|::|...||.......|...|.:....||..|.|.|::||.||..:|: .:.|
 Worm   409 VSHQHLRLDRDKYIKIDWSNIDPQHYDTFAISDAKLYTSYGTKYAYDSIMHYNAYLGAKDPNKPT 473

  Fly   219 IVPL---QEGAEELMGQRLQMTQSDINKLNVMYKCP 251
            ::||   ||...:| |||.::|:.||..|..||..|
 Worm   474 MIPLVNPQENTPKL-GQRAKLTRGDIRLLKKMYCRP 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 59/200 (30%)
ZnMc_astacin_like 61..248 CDD:239807 56/194 (29%)
nas-9NP_741532.1 Astacin 311..505 CDD:279708 57/198 (29%)
ZnMc_astacin_like 316..505 CDD:239807 56/193 (29%)
ShKT 510..546 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.