DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-32

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_503351.3 Gene:nas-32 / 178595 WormBaseID:WBGene00003550 Length:653 Species:Caenorhabditis elegans


Alignment Length:196 Identity:66/196 - (33%)
Similarity:94/196 - (47%) Gaps:16/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFK---EATTDQEYYVNVTSEAGGCYSYVG 120
            ||.::||||.:..:.|..:..:...|..:|.::||.|:   .||...:.:..|     ||||..|
 Worm   212 WPGKVVYYYFDSGLTTTVQQIVRDAITFLESNTCLKFELNSTATNRVKIFSGV-----GCYSDTG 271

  Fly   121 YRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNK 185
            ...     ..||.:|..||...||..||..|.||.:|.|...:|||||.|...::.|.::.||.|
 Worm   272 MLG-----GEQTLSLGYGCEVTGTAAHEIAHTLGLFHTQMRSDRDDYVTIDLTDVPESSQQNFIK 331

  Fly   186 YDNETVEDYGEPYDYSSVLHYTAYAF-SKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYK 249
            ....|..:..: |:|.|.:||:..|| |..|..:|||........||.|: :|..|:..||..|.
 Worm   332 LTEATSTNLVD-YEYGSFMHYSGRAFVSSGGVDSIVPKDPVMVYTMGGRI-VTFLDLKMLNTHYS 394

  Fly   250 C 250
            |
 Worm   395 C 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 66/196 (34%)
ZnMc_astacin_like 61..248 CDD:239807 62/190 (33%)
nas-32NP_503351.3 Astacin 210..397 CDD:279708 66/196 (34%)
ZnMc_astacin_like 214..393 CDD:239807 62/190 (33%)
CUB 464..>528 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.