DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and Mep1a

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus


Alignment Length:221 Identity:77/221 - (34%)
Similarity:115/221 - (52%) Gaps:12/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LTAG--YIEGDMVPSPEGRNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVF 95
            |.||  ..:||:: .|..||.:|:.:.||...|.|...: :::...:..||....:....||:.|
Mouse    60 LAAGLNLFQGDIL-LPRTRNAMRDPSSRWKLPIPYILAD-NLELNAKGAILHAFEMFRLKSCVDF 122

  Fly    96 KEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQS 160
            |....:..|.  :..:..||:|.:|    .||:. |..::..||....||.||.||||||:|:||
Mouse   123 KPYEGESSYI--IFQKLSGCWSMIG----DQQVG-QNISIGEGCDFKATIEHEILHALGFFHEQS 180

  Fly   161 TWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQE 224
            ..:|||||.|..:.|....|.|||.||:.|:.|...||||.|::||..::|:||..: ||.....
Mouse   181 RTDRDDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSFNKNESIPTITTKIP 245

  Fly   225 GAEELMGQRLQMTQSDINKLNVMYKC 250
            ....::||....:..|:.:||.||.|
Mouse   246 EFNTIIGQLPDFSAIDLIRLNRMYNC 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 68/194 (35%)
ZnMc_astacin_like 61..248 CDD:239807 63/187 (34%)
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 76/219 (35%)
MAM 281..444 CDD:366209
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.