Sequence 1: | NP_001285959.1 | Gene: | CG15254 / 34915 | FlyBaseID: | FBgn0028949 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492109.2 | Gene: | nas-36 / 172506 | WormBaseID: | WBGene00003552 | Length: | 617 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 61/203 - (30%) |
---|---|---|---|
Similarity: | 103/203 - (50%) | Gaps: | 11/203 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 RNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEA--TTDQEYYVNVTSE 111
Fly 112 AGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENIT 176
Fly 177 EGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGE-MTIVPLQEGAEELMGQRLQMTQSD 240
Fly 241 INKLNVMY 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15254 | NP_001285959.1 | Astacin | 58..251 | CDD:279708 | 59/194 (30%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 57/189 (30%) | ||
nas-36 | NP_492109.2 | Astacin | 134..323 | CDD:279708 | 59/195 (30%) |
ZnMc_astacin_like | 140..320 | CDD:239807 | 57/187 (30%) | ||
CUB | 380..478 | CDD:214483 | |||
TSP1 | 510..556 | CDD:214559 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D681837at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |