DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and LOC108645256

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031756300.1 Gene:LOC108645256 / 108645256 -ID:- Length:501 Species:Xenopus tropicalis


Alignment Length:202 Identity:70/202 - (34%)
Similarity:106/202 - (52%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSY 118
            |||...|..:...|.|.:::|     :...:.:....:|:.| ...||::.|||:|| ..||:||
 Frog    82 NETVYVPYTLDSKYSNSEVNT-----MTSAMEVYATLTCVQF-VPYTDEDDYVNITS-GDGCWSY 139

  Fly   119 VGYRNRVQQLNLQTYALDTG-CFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGN 182
            :|     :|...|..:::.| |...||.:||..|||||.|:.|..:||:||.|..:.|:.|...|
 Frog   140 MG-----RQGGAQVVSVEKGYCTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVN 199

  Fly   183 F---NKYDNETVEDYGEPYDYSSVLHYTAYAFSK-NGEMTIVPLQEGAEELMGQRLQMTQSDINK 243
            |   |..:..|:      |||.|::||.|:|||. .|:.||| .:.....::|....||..||.|
 Frog   200 FEIMNTNNLNTI------YDYRSIMHYPAWAFSNTTGKNTIV-AKLNPNIIIGAGSTMTSLDIIK 257

  Fly   244 LNVMYKC 250
            :|.:|:|
 Frog   258 INRLYEC 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 67/198 (34%)
ZnMc_astacin_like 61..248 CDD:239807 64/191 (34%)
LOC108645256XP_031756300.1 ZnMc 82..264 CDD:412141 69/200 (35%)
CUB 267..376 CDD:395345
CUB 381..492 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.