Sequence 1: | NP_001285959.1 | Gene: | CG15254 / 34915 | FlyBaseID: | FBgn0028949 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031756313.1 | Gene: | LOC105946018 / 105946018 | -ID: | - | Length: | 583 | Species: | Xenopus tropicalis |
Alignment Length: | 260 | Identity: | 78/260 - (30%) |
---|---|---|---|
Similarity: | 118/260 - (45%) | Gaps: | 60/260 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 ELTAGYIEGDMVPSPEG-----------RNGL-------------------------RNETFRWP 60
Fly 61 NRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRV 125
Fly 126 QQLNLQTYALDTG-CFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNF---NKY 186
Fly 187 DNETVEDYGEPYDYSSVLHYTAYAFSK-NGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
Fly 251 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15254 | NP_001285959.1 | Astacin | 58..251 | CDD:279708 | 67/198 (34%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 64/191 (34%) | ||
LOC105946018 | XP_031756313.1 | C2 | 92..>113 | CDD:417471 | 2/6 (33%) |
ZnMc | 164..346 | CDD:412141 | 69/200 (35%) | ||
CUB | 349..458 | CDD:395345 | |||
CUB | 463..574 | CDD:238001 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D472790at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |