DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and XB5917669

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031756322.1 Gene:XB5917669 / 100496293 XenbaseID:XB-GENE-5917670 Length:578 Species:Xenopus tropicalis


Alignment Length:260 Identity:78/260 - (30%)
Similarity:118/260 - (45%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ELTAGYIEGDMVPSPEG-----------RNGL-------------------------RNETFRWP 60
            ||...::||...|..:|           .||:                         .|||...|
 Frog   106 ELCVSFLEGKSDPFGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSAITSTECLWQKTNETVYVP 170

  Fly    61 NRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRV 125
            ..:...|.|.:::|     :...:.:....:|:.| ...||::.|||:|| ..||:||:|     
 Frog   171 YTLDSKYSNSEVNT-----MTSAMEVYATLTCVQF-VPYTDEDDYVNITS-GDGCWSYMG----- 223

  Fly   126 QQLNLQTYALDTG-CFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNF---NKY 186
            :|...|..:::.| |...||.:||..|||||.|:.|..:||:||.|..:.|:.|...||   |..
 Frog   224 RQGGAQVVSVEKGYCTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMNTN 288

  Fly   187 DNETVEDYGEPYDYSSVLHYTAYAFSK-NGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            :..|:      |||.|::||.|:|||. .|:.||| .:.....::|....||..||.|:|.:|:|
 Frog   289 NLNTI------YDYRSIMHYPAWAFSNTTGKNTIV-AKLNPNIIIGAGSTMTSLDIIKINRLYEC 346

  Fly   251  250
             Frog   347  346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 67/198 (34%)
ZnMc_astacin_like 61..248 CDD:239807 64/191 (34%)
XB5917669XP_031756322.1 C2 92..>113 CDD:417471 2/6 (33%)
ZnMc 164..346 CDD:412141 69/200 (35%)
CUB 349..458 CDD:395345
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.