DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and accs

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017948750.2 Gene:accs / 100495810 XenbaseID:XB-GENE-989873 Length:492 Species:Xenopus tropicalis


Alignment Length:218 Identity:67/218 - (30%)
Similarity:116/218 - (53%) Gaps:17/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EGDMVPSPEGRNGLRNETFRWPNRI-----VYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEA 98
            :|| :....||:..:..:..||...     |.|.::.|.....::.|...:......:|:.|.|.
 Frog    52 QGD-IAIETGRSATKCTSCLWPKSADGTVRVPYRLSADYSDNEKSSIRDALLEFNTLTCVHFVER 115

  Fly    99 TTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWN 163
            :|::: ::::.|:: ||:|.:|.....|.|:|    :.:||...|.|.||..|||||||:||..:
 Frog   116 STEED-FLDIVSDS-GCWSSIGRTGGAQTLSL----MSSGCLAKGIIQHEVDHALGFYHEQSRSD 174

  Fly   164 RDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSK-NGEMTIVPLQEGAE 227
            ||.|:.:..:.|.|...|:|...|.:.::   .|||||||:||..||||. :|:.::.|..:...
 Frog   175 RDTYIDVLWQYICESDWGSFEMVDTDNLD---LPYDYSSVMHYGWYAFSNTSGQPSLRPKPDPTA 236

  Fly   228 ELMGQRLQMTQSDINKLNVMYKC 250
            .: |||..::..|::|:..:|.|
 Frog   237 NI-GQRYGLSPLDVSKVKELYGC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 63/199 (32%)
ZnMc_astacin_like 61..248 CDD:239807 59/192 (31%)
accsXP_017948750.2 ZnMc 76..258 CDD:412141 60/191 (31%)
CUB 261..374 CDD:238001
CUB 377..488 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.