DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and astl3b.4

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_031746772.1 Gene:astl3b.4 / 100491283 XenbaseID:XB-GENE-22069691 Length:533 Species:Xenopus tropicalis


Alignment Length:217 Identity:82/217 - (37%)
Similarity:117/217 - (53%) Gaps:16/217 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EGDMVPSPEGRNGLRNETFRWPNR-----IVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEA 98
            |||:: .||||:.:......||..     ||.|..:.:...:........::..|..:|:.| ..
 Frog    95 EGDIL-RPEGRSAMNCTECLWPKSTDGTVIVPYNFSSNYSADQLALFKSAMQEYESLTCVRF-VP 157

  Fly    99 TTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWN 163
            ..::..::|:.| ..||.|::|.....|.:.|.:|    ||...|.|.||..|||||||:||..:
 Frog   158 RANETAFLNIIS-GSGCVSFLGKLGGAQTVQLASY----GCIYRGIIQHELNHALGFYHEQSRSD 217

  Fly   164 RDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEE 228
            |||||.|..|||..|.||||||.:...:   |..||||||:||...||||||.:||||..:....
 Frog   218 RDDYVTIHTENILPGYEGNFNKANTNNL---GLEYDYSSVMHYPGDAFSKNGNLTIVPKPDPTVP 279

  Fly   229 LMGQRLQMTQSDINKLNVMYKC 250
            : |||..::..|::|:|.:|:|
 Frog   280 I-GQRDGLSILDVSKINRLYQC 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 75/198 (38%)
ZnMc_astacin_like 61..248 CDD:239807 71/191 (37%)
astl3b.4XP_031746772.1 ZnMc_hatching_enzyme 119..300 CDD:239810 72/190 (38%)
CUB 304..412 CDD:238001
CUB 417..525 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.