DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and XB5949052

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002932488.2 Gene:XB5949052 / 100489456 XenbaseID:XB-GENE-5949053 Length:453 Species:Xenopus tropicalis


Alignment Length:290 Identity:75/290 - (25%)
Similarity:123/290 - (42%) Gaps:64/290 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVVIF--LASSCSAAPTTQ-NRIETDP----ELTAG-----------YIEGDMVP---------- 44
            ||::|  |..||.|.||.: |....:|    :.|||           .:..|.:|          
 Frog     3 LVLLFAALCGSCLAFPTQKPNETPIEPTERNQATAGEENKSMFDRLYEVNKDALPFTGKYIVSNL 67

  Fly    45 ------------SPEGRNGLRNETFRWPNRI-----VYYYINRDIDTEHRNHILRGIRIIEQSSC 92
                        .|:|       ...||...     :.|.|:.|..:..........:....::|
 Frog    68 DIALKLGKSANTCPKG-------ICLWPKSSDGLVRIPYVISSDYSSYSNALFQASFKGFADTTC 125

  Fly    93 LVFKEATTDQEYYVNVTSEA-GGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFY 156
            :.....|::.:|   ::.|: .||:|.:|.....|.:::|    .:||.....|.||.:|:||.:
 Frog   126 IRLVPRTSETDY---LSFESLNGCWSPIGRTGGAQTVSVQ----QSGCMWTSIIEHEIIHSLGLH 183

  Fly   157 HQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIV 220
            |:....:||.||.:...||:.|..|||...|...:.  ...|||:|::||::.|||.||.: |::
 Frog   184 HEHVRSDRDKYVSVQWNNISPGNTGNFQMTDTNNMN--LTKYDYNSLMHYSSTAFSINGNLPTLI 246

  Fly   221 PLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            .:.:.:.. .|....|:..||.|||.:|||
 Frog   247 AVPDSSVS-FGNAFMMSDLDIKKLNTLYKC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 57/200 (29%)
ZnMc_astacin_like 61..248 CDD:239807 52/193 (27%)
XB5949052XP_002932488.2 ZnMc 92..275 CDD:412141 53/192 (28%)
CUB 342..452 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.