DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and mep1ba

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001070089.2 Gene:mep1ba / 100151009 ZFINID:ZDB-GENE-041014-209 Length:677 Species:Danio rerio


Alignment Length:265 Identity:89/265 - (33%)
Similarity:134/265 - (50%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LASSCS-----------AAPTTQNRIETDPELTAG---------------YIEGD-MVPSPEGRN 50
            :||:||           ..||:....:|:.::..|               .:||| ::...|.||
Zfish     1 MASACSYLFLSVCVTVLCLPTSSVTGDTEIDVDHGTDLDIFEINEVAGLDLVEGDILIEEGESRN 65

  Fly    51 GLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGC 115
            .:..|.:|||. .|.|:::..::...:..||:........:|:.||....:..|.  ...:..||
Zfish    66 TILGEQYRWPT-TVPYFLDNSLEINAKGVILKAFEQYRLKTCIDFKPWNGESNYI--FVFKGSGC 127

  Fly   116 YSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTE 180
            ||.||.|    |:..|..::.:.|..|||:.||||||||.:|:||..:|||||.|..:.|.:|.|
Zfish   128 YSKVGNR----QMGKQELSIGSNCDSLGTVEHEFLHALGLWHEQSRSDRDDYVIIVWDQIQDGKE 188

  Fly   181 GNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLN 245
            .|||.||.......|.|||||||:||:..:|:|..|.|||........::|||::.:.:|:.|||
Zfish   189 HNFNLYDETQSSSLGVPYDYSSVMHYSKTSFNKGSEPTIVTKIPEFLNVIGQRMEFSDNDLLKLN 253

  Fly   246 VMYKC 250
            .:|.|
Zfish   254 RLYNC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 74/193 (38%)
ZnMc_astacin_like 61..248 CDD:239807 69/186 (37%)
mep1baNP_001070089.2 ZnMc_meprin 29..258 CDD:239809 81/235 (34%)
Astacin 72..260 CDD:279708 74/194 (38%)
MAM 268..432 CDD:279023
MAM 268..430 CDD:99706
MATH_Meprin_Beta 430..599 CDD:239751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.