DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and LOC797085

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:211 Identity:70/211 - (33%)
Similarity:103/211 - (48%) Gaps:41/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WPNR----TVPYMI----EDDAFADSHYREILRAISIIEENSCVIF-KPATEMDF----PMALVI 104
            ||.:    :|||.|    ||..   .|   ||.|:.::.:.:||.| ...||.|:    |..:..
Zfish   102 WPEKDGEVSVPYSIASGLEDKT---GH---ILAALKMVSKKTCVKFHHHTTEEDYLHFKPDRMCA 160

  Fly   105 TSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQW 169
            :.  :||    .|......|        |..| ..|:|.||:||.||..|:|...:||:|::|.:
Zfish   161 SL--VGC----AGGEQPILV--------GPKC-NAGNICHEILHSLGLYHEHSRPDRDKYITILY 210

  Fly   170 KNINPQYNINF-VNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLREGAENMGQRFYM 233
            .||.|....|| |...|:....     ||.:|::||....|||||..||:|.::|.: :|||.:|
Zfish   211 DNIMPGKESNFKVKKGNTLGLE-----YDLDSILHYGDDCFSRNGNHTIIPKKKGVK-IGQRTHM 269

  Fly   234 SEKDIRKLNKMYRCPD 249
            |..|:.:|.::|.|.|
Zfish   270 SVLDVERLRRLYHCDD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 69/209 (33%)
ZnMc_astacin_like 55..245 CDD:239807 65/203 (32%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 65/196 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.