DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and he1.3

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001091658.1 Gene:he1.3 / 792176 ZFINID:ZDB-GENE-040518-1 Length:271 Species:Danio rerio


Alignment Length:229 Identity:71/229 - (31%)
Similarity:116/229 - (50%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QGDIKAHPIRTRNGIV--NQIYHWPNRT-----VPYMIEDDAFADSHYREILRAISIIEENSCVI 89
            :||: .:| :|||.:|  |....|...:     |||::..: ::.:....|.:|:|.|...:|:.
Zfish    55 EGDM-LYP-QTRNALVCGNNNCFWKKNSSNFVEVPYIVSSE-YSATEISVIQKAMSGIHNKTCIR 116

  Fly    90 FKP-ATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFE 153
            |.| .::.|:   :.|.::. || ...:|.....|:|:|.    .:||.....:.|||.|.|||.
Zfish   117 FVPRISQTDY---ISIENQD-GC-FAFIGKNGGKQLVSLR----KKGCVYHSIVQHELNHALGFY 172

  Fly   154 HQHVSQNRDQYVSIQWKNINPQYNINFV----NNDNSTAWHDFDEGYDYESVMHYVPRAFSR-NG 213
            |:||..:||.|::|.|:.|......||:    |:.|:|        |||.|:|||...||:. .|
Zfish   173 HEHVRSDRDSYITIHWEYIATNEIRNFMKKNTNSQNTT--------YDYGSIMHYGKTAFTTVKG 229

  Fly   214 QPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            :.|:.|..:....:|:...||:.||.::|.||.|
Zfish   230 KETMTPYPDETVPIGKAKEMSDIDILRINMMYSC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 63/206 (31%)
ZnMc_astacin_like 55..245 CDD:239807 59/200 (30%)
he1.3NP_001091658.1 ZnMc 82..263 CDD:294052 61/198 (31%)
Astacin 86..264 CDD:279708 62/196 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.