DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and c6ast1

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:242 Identity:77/242 - (31%)
Similarity:119/242 - (49%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SELFKDPELLAG-------FYQGDIK-AHPIRTRNGIVNQIYHWPNRT-----VPYMIEDDAFAD 69
            |.|.:.|...||       ...|||. ..|:........|...||..:     |||:|.|: ::.
Zfish    29 SALMERPSNFAGEELDEPSIMFGDIAVGTPLDITAPCTGQSCKWPLSSNGKVFVPYIISDE-YST 92

  Fly    70 SHYREILRAISIIEENSCVIFKP-ATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLG 133
            .....|.:....:|:::||.|:| .|:.|:    :......||.: .:|.|...|.|:|:    .
Zfish    93 QEKDVIFQGFRSLEKSTCVRFRPRTTQRDY----INIEPNSGCYS-FVGRRTGGQTVSLD----H 148

  Fly   134 EGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDY 198
            :||.::..:.|||||.|||.|:|...:||.:|.|.:|||.|....||    :....::.:..|||
Zfish   149 DGCIKLNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIPGQERNF----DKIKTNNLETAYDY 209

  Fly   199 ESVMHYVPRAFSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMY 245
            .|||||...|||:|.:.||||:.:....:|:...||..||.::|::|
Zfish   210 SSVMHYGRFAFSKNKEATIVPIPDSGVTIGRAKRMSSNDILRINRLY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 67/199 (34%)
ZnMc_astacin_like 55..245 CDD:239807 64/195 (33%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 67/200 (34%)
ZnMc_hatching_enzyme 77..257 CDD:239810 65/194 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.