| Sequence 1: | NP_609756.1 | Gene: | Semp1 / 34914 | FlyBaseID: | FBgn0028944 | Length: | 251 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036597.1 | Gene: | TLL2 / 7093 | HGNCID: | 11844 | Length: | 1015 | Species: | Homo sapiens |
| Alignment Length: | 201 | Identity: | 65/201 - (32%) |
|---|---|---|---|
| Similarity: | 105/201 - (52%) | Gaps: | 15/201 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 WPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLG 117
Fly 118 YR-NKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFV 181
Fly 182 NNDNSTAWHDFDEGYDYESVMHYVPRAFSRN-GQPTIVPLREG---AENMGQRFYMSEKDIRKLN 242
Fly 243 KMYRCP 248 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Semp1 | NP_609756.1 | Astacin | 53..249 | CDD:279708 | 65/201 (32%) |
| ZnMc_astacin_like | 55..245 | CDD:239807 | 60/194 (31%) | ||
| TLL2 | NP_036597.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 24..49 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 88..130 | ||||
| ZnMc_BMP1_TLD | 150..349 | CDD:239808 | 63/199 (32%) | ||
| Astacin | 157..350 | CDD:279708 | 65/201 (32%) | ||
| CUB | 351..460 | CDD:278839 | |||
| CUB | 464..573 | CDD:278839 | |||
| FXa_inhibition | 584..616 | CDD:291342 | |||
| CUB | 620..729 | CDD:278839 | |||
| FXa_inhibition | 736..771 | CDD:291342 | |||
| CUB | 776..885 | CDD:278839 | |||
| CUB | 889..1002 | CDD:278839 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||