DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and TLL1

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036596.3 Gene:TLL1 / 7092 HGNCID:11843 Length:1013 Species:Homo sapiens


Alignment Length:204 Identity:69/204 - (33%)
Similarity:109/204 - (53%) Gaps:21/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLG 117
            ||...:||:|..: |..|......:|:...|:::||.|  ....|....:|.|.:..||.: ::|
Human   157 WPGGVIPYVIGGN-FTGSQRAMFKQAMRHWEKHTCVTF--IERSDEESYIVFTYRPCGCCS-YVG 217

  Fly   118 YR-NKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFV 181
            .| |..|.::     :|:.|.:.|.::|||.||:||.|:|...:||.:|:|..:||.|....||:
Human   218 RRGNGPQAIS-----IGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFL 277

  Fly   182 NNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQ--PTIVPLREGAEN-----MGQRFYMSEKDIR 239
            ..:.... :...|.||::|:|||....||| |.  .||:|.|:  :|     :|||..:|:.||.
Human   278 KMEPGEV-NSLGERYDFDSIMHYARNTFSR-GMFLDTILPSRD--DNGIRPAIGQRTRLSKGDIA 338

  Fly   240 KLNKMYRCP 248
            :..|:||||
Human   339 QARKLYRCP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 69/204 (34%)
ZnMc_astacin_like 55..245 CDD:239807 63/197 (32%)
TLL1NP_036596.3 ZnMc_BMP1_TLD 148..347 CDD:239808 67/202 (33%)
Astacin 155..348 CDD:279708 69/204 (34%)
CUB 349..458 CDD:278839
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.