DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and tnfaip6

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:201 Identity:37/201 - (18%)
Similarity:81/201 - (40%) Gaps:49/201 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RNGIVNQ---------IYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIF---KPATE 95
            :|||::.         :||..:|...|.:.        |:| .:|:...|..:...|   :.|.:
Zfish    31 KNGILHNSIWLEQAAGVYHRESRKGRYQLT--------YKE-AKAVCNFEGGTLATFDQLEAARQ 86

  Fly    96 MDFPMALV-----------ITSKGLGC-----NTVHLGYR-NKTQVVNLEIY-PLGEGCFRIGSI 142
            :.|.:...           |...|..|     ..:..||| ||::..::..| |:.:.|..:.:.
Zfish    87 IGFHVCAAGWLDKGRVGYPIVKAGSNCGFGKVGIIDYGYRLNKSERWDVYCYNPVAKECGGVHTD 151

  Fly   143 IHELLHVLGFEHQHVSQNRDQ-----YVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYD-YESV 201
            ..::|...|:..::    :|:     ::.:::.:....:.::|...:::....|..|.|| |:.|
Zfish   152 PEKVLVSPGYPDEY----QDEQICYWHIRVRFGHRIRLHFLDFDIEEDTDCLSDHLEIYDSYDDV 212

  Fly   202 MHYVPR 207
            ..:|.|
Zfish   213 SGFVGR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 32/182 (18%)
ZnMc_astacin_like 55..245 CDD:239807 32/180 (18%)
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 19/100 (19%)
CUB 145..254 CDD:278839 13/78 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.