DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and astl2c

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001037864.1 Gene:astl2c / 594901 XenbaseID:XB-GENE-6449741 Length:496 Species:Xenopus tropicalis


Alignment Length:248 Identity:82/248 - (33%)
Similarity:122/248 - (49%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VFSELFKDPELLAGFY-QGDIKAHPI-------------RTRNGIVNQIYHWPNRTVPYMIEDDA 66
            ||..:.:..:....|: |||| ||..             :..|||||         |||.|..| 
 Frog    43 VFGRILRANKGKRNFHVQGDI-AHKFSRSAINCKECLWPKDSNGIVN---------VPYTISSD- 96

  Fly    67 FADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYP 131
            ::.:....|:.|:......:||.|.|.|:.|..:|:....   ||.: ::|.....|.|:     
 Frog    97 YSQNEASLIMAAMQEFATLTCVQFIPQTDEDDYIAIQPLD---GCWS-YIGVNGGAQQVS----- 152

  Fly   132 LGE-GCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEG 195
            ||: ||...|.|.|||.|||||.|:|...:||.||.|.::.|:|. ||.|.:..::   .:....
 Frog   153 LGKGGCIYYGVIQHELNHVLGFVHEHSRSDRDNYVHINYQYISPD-NIAFFDKKDT---DNLGLE 213

  Fly   196 YDYESVMHYVPRAFSR-NGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            |||.|||||...::|. .|:.||||:......:|||:.:|..|:.|:|::|:|
 Frog   214 YDYSSVMHYPGYSYSNTTGKNTIVPIPNANVPIGQRYGLSTLDVSKINRLYQC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 68/197 (35%)
ZnMc_astacin_like 55..245 CDD:239807 66/191 (35%)
astl2cNP_001037864.1 ZnMc_hatching_enzyme 84..266 CDD:239810 72/204 (35%)
Astacin 89..266 CDD:279708 67/190 (35%)
CUB 270..380 CDD:238001
CUB 383..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.