DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and mep1a.2

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001122199.1 Gene:mep1a.2 / 565535 ZFINID:ZDB-GENE-041001-208 Length:689 Species:Danio rerio


Alignment Length:227 Identity:78/227 - (34%)
Similarity:112/227 - (49%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIED--DAFADSHYREILRAISIIEENSCVIFKP- 92
            ::|||...|  .||.|:::...| ...:||::.|  |..|..   .||:|:.:....|||.||| 
Zfish    50 FEGDIAGDP--RRNAIIDEKARW-QFPIPYILTDTLDLNAKG---VILQALEMYRLKSCVDFKPY 108

  Fly    93 ---ATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEH 154
               :|.:.|       :|..||.: .:|.....|.|:     :||.|.....:.|||||.|||.|
Zfish   109 EGESTYISF-------TKLDGCWS-FVGDLKTGQNVS-----IGERCDTKAIVEHELLHALGFYH 160

  Fly   155 QHVSQNRDQYVSIQWKNI--NPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQ-PT 216
            :....:||.||.|.|..|  ..::|.|...:|..|   |.:..|||||:|||.|.:|:::.. ||
Zfish   161 EQSRSDRDDYVKIWWDQIIEGKEHNFNKYEDDFIT---DLNTPYDYESIMHYRPLSFNKDPDIPT 222

  Fly   217 IVPLREGAEN-MGQRFYMSEKDIRKLNKMYRC 247
            |........| :|||...|..|:.:||:||.|
Zfish   223 ITTTIPAFNNIIGQRLDFSALDLERLNRMYEC 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 71/205 (35%)
ZnMc_astacin_like 55..245 CDD:239807 67/199 (34%)
mep1a.2NP_001122199.1 ZnMc 26..254 CDD:294052 77/225 (34%)
Astacin 68..256 CDD:279708 71/207 (34%)
MAM 259..423 CDD:214533
MAM 264..423 CDD:99706
MATH 423..579 CDD:295307
EGF 619..653 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.