DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and hce2l1

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_009302797.1 Gene:hce2l1 / 564183 ZFINID:ZDB-GENE-070912-147 Length:232 Species:Danio rerio


Alignment Length:234 Identity:82/234 - (35%)
Similarity:115/234 - (49%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ELLAGF--YQGDIKAHPIRTRNGIVNQIYHWPNRT-----VPYMIEDDAFADSHYREILRAISII 82
            :|..||  .:|||.:...|:....:.....||...     ||| |....:.|.....|...:..|
Zfish    12 QLSRGFPLREGDILSPGSRSAITCLGDSCRWPKAVDGFVYVPY-IMSTLYDDMDRITIETGMLDI 75

  Fly    83 EENSCVIFKPAT-EMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHEL 146
            ..::||.|.|.| :.:|   |.|..: .||.: :||....:|.|:|:    ..||...|...|||
Zfish    76 SSSTCVKFVPRTHQANF---LNIQPR-YGCWS-YLGMTGGSQTVSLQ----SPGCMWSGVASHEL 131

  Fly   147 LHVLGFEHQHVSQNRDQYVSIQWKNI--NPQYNI-NFVNNDNSTAWHDFDEGYDYESVMHYVPRA 208
            :|.|||.|:....:||:||||.|:||  |.::|. .:..|:.:||       |||.|||||...|
Zfish   132 MHALGFVHEQSRSDRDRYVSILWENIIENQRHNFRKYETNNLNTA-------YDYSSVMHYGRYA 189

  Fly   209 FSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            ||.:|.|||:|..:....:|||...|..||.|:|.:|.|
Zfish   190 FSEDGGPTIIPKPDPYIPIGQRDGPSILDIHKINILYNC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 75/204 (37%)
ZnMc_astacin_like 55..245 CDD:239807 71/198 (36%)
hce2l1XP_009302797.1 Astacin 41..229 CDD:279708 75/205 (37%)
ZnMc_hatching_enzyme 47..228 CDD:239810 72/197 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.