DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and tll1

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001008039.1 Gene:tll1 / 493401 XenbaseID:XB-GENE-479941 Length:495 Species:Xenopus tropicalis


Alignment Length:255 Identity:81/255 - (31%)
Similarity:122/255 - (47%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PTVFSELFKDP---ELLAGFYQGDIKAHPIR---------TRNGIVNQIYHWPNRT-----VPYM 61
            ||..|:..|||   .|.....:.:.|:..:|         .||.|......||..:     |||.
 Frog    27 PTPKSQDGKDPADNNLYTDIMKANQKSKKLRIHGDIALKTDRNAINCTECLWPKSSDGFVYVPYT 91

  Fly    62 IEDDAFADSHYREILRAISIIEENSCVIFKPAT-EMDFPMALVITSKGLGCNTVHLGYRNKTQVV 125
            :..| ::......|..|:...|..:||.|.|.| |.|:   |.|.|.. ||.: ::||...:|.|
 Frog    92 VSSD-YSQDEVNAITTAMKEYEGLTCVQFTPWTGEDDY---LAIQSLD-GCWS-YIGYYGGSQAV 150

  Fly   126 NLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWH 190
            :|    |...|...|.:.|||.|.|||.|:|...:||.||:|.::.|:|:.    :.|.:..:.:
 Frog   151 SL----LKGFCAYNGGVQHELNHALGFYHEHNRSDRDDYVTIMYQYISPEN----IGNFDKISTN 207

  Fly   191 DFDEGYDYESVMHYVPRAFSR-NGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRCPD 249
            :....|||.|::||...|||. :||.||||.......:||.:.:|..|:.|:|::|.|.:
 Frog   208 NLGVDYDYSSILHYAGNAFSNTSGQNTIVPHPNPNVPIGQSYGLSNLDVLKINRLYGCDE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 69/202 (34%)
ZnMc_astacin_like 55..245 CDD:239807 65/196 (33%)
tll1NP_001008039.1 ZnMc_hatching_enzyme 83..265 CDD:239810 66/195 (34%)
CUB 269..379 CDD:238001
CUB 382..494 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.