DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and ASTL

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011509507.1 Gene:ASTL / 431705 HGNCID:31704 Length:436 Species:Homo sapiens


Alignment Length:232 Identity:80/232 - (34%)
Similarity:118/232 - (50%) Gaps:41/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QGD-IKAHPIRTRNGIVNQIYHWPNR-----TVPYMIEDDAFADSHYRE-----ILRAISIIEEN 85
            :|| |:..|.|..:...|:   ||..     .||:::      .|.|.|     ||.|::..|.:
Human    80 EGDIIRPSPFRLLSATSNK---WPMGGSGVVEVPFLL------SSKYDEPSRQVILEALAEFERS 135

  Fly    86 SCVIFKP-ATEMDF----PMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHE 145
            :|:.|.. ..:.||    ||        .||.: .:|.....|||:|....|.:|   .|.::||
Human   136 TCIRFVTYQDQRDFISIIPM--------YGCFS-SVGRSGGMQVVSLAPTCLQKG---RGIVLHE 188

  Fly   146 LLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFS 210
            |:|||||.|:|...:||:|:.:.|..|.|.:.|||:.:.:|    :....|||.|||||...|||
Human   189 LMHVLGFWHEHTRADRDRYIRVNWNEILPGFEINFIKSQSS----NMLTPYDYSSVMHYGRLAFS 249

  Fly   211 RNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            |.|.|||.||...:.::|||:.:|..||.::.|:|.|
Human   250 RRGLPTITPLWAPSVHIGQRWNLSASDITRVLKLYGC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 74/210 (35%)
ZnMc_astacin_like 55..245 CDD:239807 70/204 (34%)
ASTLXP_011509507.1 Astacin 97..288 CDD:279708 75/215 (35%)
ZnMc 105..286 CDD:294052 71/202 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.