DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and CG5715

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster


Alignment Length:239 Identity:94/239 - (39%)
Similarity:121/239 - (50%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DPELLAGFYQGDIKAHPIR--------TRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAI 79
            :||.|..:::|||.. |:.        |||||:.....||...|||.|: ..|.......|..|.
  Fly    68 NPEELGTYHEGDILI-PLSYRDARFNGTRNGILALSSRWPGGVVPYEIK-GPFTSQELGNINHAF 130

  Fly    80 SIIEENSCVIFKP-ATEMDFPMALVITSKGLGC--NTVHLGYRNKTQVVNLEIYPLGEGCFR-IG 140
            ......:||.||| .||.|:   :.|.|...||  :...||.|   |.|||:    ...|.| .|
  Fly   131 KEYHTKTCVRFKPRTTEKDY---ISIGSGKSGCWSSIGRLGGR---QEVNLQ----SPNCLRTYG 185

  Fly   141 SIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYV 205
            :.||||:|.|||.|:.....||.||.:...||.|:..:||..:.:.|. :.|...|||.|||||.
  Fly   186 TPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQ-YGFGVEYDYGSVMHYS 249

  Fly   206 PRAFSRNGQPTIVPLR--EGAENMGQRFYMSEKDIRKLNKMYRC 247
            |.:|:||||||:..||  ..|..||||...|..|:||:|.||:|
  Fly   250 PTSFTRNGQPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 82/201 (41%)
ZnMc_astacin_like 55..245 CDD:239807 77/195 (39%)
CG5715NP_651242.1 Astacin 104..295 CDD:279708 82/202 (41%)
ZnMc_astacin_like 107..291 CDD:239807 77/195 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444822
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.