DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and MEP1B

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens


Alignment Length:267 Identity:87/267 - (32%)
Similarity:131/267 - (49%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IWGVI-FLF-----------TPTVF-------SELFKDPELLA-GFYQGDIKAHPIRTRNGIVNQ 49
            :|.:. |||           ||..|       .::|...|.|. ..::|||:....:.||.|:.:
Human     3 LWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRNSIIGE 67

  Fly    50 IYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKP-ATEMDFPMALVITSKGLGCNT 113
            .|.||: |:||::||....::. ..||.|.......:|:.||| |.|.::    :...||.||.:
Human    68 KYRWPH-TIPYVLEDSLEMNAK-GVILNAFERYRLKTCIDFKPWAGETNY----ISVFKGSGCWS 126

  Fly   114 VHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNI--NPQY 176
             .:|.|.    |..:...:|..|.||.::.||.||.|||.|:....:||.||.|.|..|  ..::
Human   127 -SVGNRR----VGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREH 186

  Fly   177 NINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVP-LREGAENMGQRFYMSEKDIRK 240
            |.|..::|.|.:   .:..|||.|||||...||....:||||. :.:..:.:|||...|:.|:.|
Human   187 NFNTYSDDISDS---LNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLK 248

  Fly   241 LNKMYRC 247
            ||::|.|
Human   249 LNQLYNC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 70/199 (35%)
ZnMc_astacin_like 55..245 CDD:239807 66/193 (34%)
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 80/242 (33%)
Astacin 69..257 CDD:279708 71/201 (35%)
MAM 260..427 CDD:214533
MAM 265..427 CDD:99706
MATH 427..586 CDD:295307
Required for proteolytic processing 595..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.