DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and MEP1A

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011512930.1 Gene:MEP1A / 4224 HGNCID:7015 Length:774 Species:Homo sapiens


Alignment Length:239 Identity:82/239 - (34%)
Similarity:116/239 - (48%) Gaps:32/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLAG--FYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCV 88
            |.||  .:||||...  ::|||:.:....| ...:||::.|:...::. ..||.|..:....|||
Human    76 LAAGLDLFQGDILLQ--KSRNGLRDPNTRW-TFPIPYILADNLGLNAK-GAILYAFEMFRLKSCV 136

  Fly    89 IFKPATEMDFPMALVITSKGLGC----NTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHV 149
            .|||   .:...:.:|..:..||    ...|:|.       |:.|   |:||.....|.||:||.
Human   137 DFKP---YEGESSYIIFQQFDGCWSEVGDQHVGQ-------NISI---GQGCAYKAIIEHEILHA 188

  Fly   150 LGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQ 214
            |||.|:....:||.||:|.|..|...|..||...|:|.. .|.:..|||||:|||.|.:|::|..
Human   189 LGFYHEQSRTDRDDYVNIWWDQILSGYQHNFDTYDDSLI-TDLNTPYDYESLMHYQPFSFNKNAS 252

  Fly   215 -PTI-VPLREGAENMGQRFYMSEKDIRKLNKMYRCP------DH 250
             ||| ..:.|....:|||...|..|:.:||:||.|.      ||
Human   253 VPTITAKIPEFNSIIGQRLDFSAIDLERLNRMYNCTTTHTLLDH 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 70/207 (34%)
ZnMc_astacin_like 55..245 CDD:239807 66/195 (34%)
MEP1AXP_011512930.1 ZnMc_meprin 58..287 CDD:239809 79/228 (35%)
Astacin 101..289 CDD:279708 70/203 (34%)
MAM 292..459 CDD:214533 2/5 (40%)
MAM 297..459 CDD:99706 82/239 (34%)
MATH_Meprin_Alpha 459..622 CDD:239752
EGF_CA 700..738 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.