DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and he1.2

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_998800.2 Gene:he1.2 / 407971 ZFINID:ZDB-GENE-030131-2100 Length:263 Species:Danio rerio


Alignment Length:230 Identity:77/230 - (33%)
Similarity:116/230 - (50%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YQGDIKAHPIRTRNGIV--NQIYHWPNRT-----VPYMIEDDAFADSHYREILRAISIIEENSCV 88
            ::||:...  :.||.::  ::...|....     |||::..: |:.:....|..||||....:|:
Zfish    54 FEGDVVLP--KNRNALICEDKSCFWKKNANNIVEVPYVVSGE-FSINDKSVIANAISIFHAQTCI 115

  Fly    89 IFKP-ATEMDFPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGF 152
            .|.| :.:.|:   |.|.:|. ||.:. :|.....|||:|.    .:||...|...|||.|.|||
Zfish   116 RFVPRSIQADY---LSIENKD-GCYSA-IGRTGGKQVVSLN----RKGCVYSGIAQHELNHALGF 171

  Fly   153 EHQHVSQNRDQYVSIQWKNINPQYNINFV----NNDNSTAWHDFDEGYDYESVMHYVPRAFS-RN 212
            .|:....:|||||.|.|.||:|....||:    ||.|:.        |||.|:|||...||: :.
Zfish   172 YHEQSRSDRDQYVRINWNNISPGMAYNFLKQKTNNQNTP--------YDYGSLMHYGKTAFAIQP 228

  Fly   213 GQPTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            |..||.|:.:....:|||..:|:.||.::||:|.|
Zfish   229 GLETITPIPDENVQIGQRQGLSKIDILRINKLYGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 73/206 (35%)
ZnMc_astacin_like 55..245 CDD:239807 70/200 (35%)
he1.2NP_998800.2 ZnMc_hatching_enzyme 81..263 CDD:239810 71/199 (36%)
Astacin 86..263 CDD:279708 71/194 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.