DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and CG10280

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:238 Identity:86/238 - (36%)
Similarity:125/238 - (52%) Gaps:19/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DPELLAGFYQGDIKAHP---IRTRNGIVNQIYH----WPNRTVPYMIEDDAFADSHYREILRAIS 80
            |||.:...:||||...|   |..|.| ||.:.|    |||.|:|:.| ...:|:...:.|::|:.
  Fly   113 DPETMPRLFQGDIAIDPYTYITLRLG-VNPMRHPKRLWPNGTIPFEI-SPRYANQERQAIIQAVK 175

  Fly    81 IIEENSCVIFKPAT-EMDFPMALVITSKG-LGCNTVHLGYRNKTQVVNLEIYPLGEG-CFRI-GS 141
            .....:||.|.|.. |:|..:.:....:| .||.: ::|.|...|||:|:....... ||.. |.
  Fly   176 TFNSLTCVHFVPYDGEVDDYLLIEPPLEGPQGCWS-YVGRRGGEQVVSLQRPDENSAHCFSSEGR 239

  Fly   142 IIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVP 206
            |:|||:|.:|..|:....:||.:|.|.|.||.|::..||.........:.||  |||.|||||..
  Fly   240 IMHELMHAIGIYHEQSRADRDNFVKIHWDNIVPRFRKNFKLVSKKKGKYAFD--YDYNSVMHYGE 302

  Fly   207 RAFS-RNGQ-PTIVPLREGAENMGQRFYMSEKDIRKLNKMYRC 247
            ..|| |.|: ||:.||:.|. .:|||..:|:.|..|:|::|.|
  Fly   303 FYFSKRKGEKPTMTPLQPGV-RIGQRKTISKIDCLKINELYGC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 72/201 (36%)
ZnMc_astacin_like 55..245 CDD:239807 68/195 (35%)
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 71/201 (35%)
ZnMc_astacin_like 151..342 CDD:239807 68/195 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.