DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and npsn

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_991319.2 Gene:npsn / 404039 ZFINID:ZDB-GENE-040420-2 Length:280 Species:Danio rerio


Alignment Length:215 Identity:75/215 - (34%)
Similarity:110/215 - (51%) Gaps:42/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEEN-------SCVIFKPAT-EMD 97
            |:|:|:|         .|||.| ..|::.       |.:::||:.       ||:.|.|.| |.:
Zfish    90 RSRDGLV---------YVPYQI-SRAYSP-------REVAVIEQGLQSFSAVSCIRFVPHTGERN 137

  Fly    98 FPMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRD 162
            :   |.|.|:. ||.: :||.....|||:|:    .:||....::.|||||.|||.|:....:||
Zfish   138 Y---LNIKSES-GCYS-YLGRIGGGQVVSLQ----RQGCVYFSTVQHELLHALGFHHEQNRSDRD 193

  Fly   163 QYVSIQWKNINP--QYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLREGAE 225
            .::.|.::||.|  |||.|..|.:|      ....|||.|||.|...|||.|.|||:||:.....
Zfish   194 NHIRILYQNIIPAQQYNFNKQNTNN------LGTPYDYNSVMQYSRYAFSMNNQPTMVPVPNANV 252

  Fly   226 NMGQRFYMSEKDIRKLNKMY 245
            .:|:...||..||.::|::|
Zfish   253 VLGEAQSMSPNDILRINRLY 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 71/203 (35%)
ZnMc_astacin_like 55..245 CDD:239807 70/199 (35%)
npsnNP_991319.2 Astacin 87..275 CDD:279708 75/215 (35%)
ZnMc_hatching_enzyme 93..273 CDD:239810 73/212 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.