| Sequence 1: | NP_609756.1 | Gene: | Semp1 / 34914 | FlyBaseID: | FBgn0028944 | Length: | 251 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001178827.1 | Gene: | Tll2 / 365460 | RGDID: | 1559756 | Length: | 1014 | Species: | Rattus norvegicus |
| Alignment Length: | 201 | Identity: | 65/201 - (32%) |
|---|---|---|---|
| Similarity: | 105/201 - (52%) | Gaps: | 15/201 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 WPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLG 117
Fly 118 YR-NKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFV 181
Fly 182 NNDNSTAWHDFDEGYDYESVMHYVPRAFSRN-GQPTIVPLREG---AENMGQRFYMSEKDIRKLN 242
Fly 243 KMYRCP 248 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Semp1 | NP_609756.1 | Astacin | 53..249 | CDD:279708 | 65/201 (32%) |
| ZnMc_astacin_like | 55..245 | CDD:239807 | 60/194 (31%) | ||
| Tll2 | NP_001178827.1 | ZnMc_BMP1_TLD | 149..348 | CDD:239808 | 63/199 (32%) |
| Astacin | 156..349 | CDD:279708 | 65/201 (32%) | ||
| CUB | 350..459 | CDD:278839 | |||
| CUB | 463..572 | CDD:278839 | |||
| FXa_inhibition | 583..615 | CDD:291342 | |||
| CUB | 619..728 | CDD:278839 | |||
| FXa_inhibition | 735..770 | CDD:291342 | |||
| CUB | 775..884 | CDD:278839 | |||
| CUB | 888..1001 | CDD:278839 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||