DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and nas-39

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001360030.1 Gene:nas-39 / 3565986 WormBaseID:WBGene00003555 Length:928 Species:Caenorhabditis elegans


Alignment Length:256 Identity:78/256 - (30%)
Similarity:121/256 - (47%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IWGVIFLFTPTVFSELFKDPELLAGFYQ-GDIKAHPIRTRNGIVNQIYH------WPNRTVPYMI 62
            |..:||||....|        :|..|.: ||::.......||.|::...      ||...:|::|
 Worm    10 IVNIIFLFIVVEF--------VLPTFIRSGDVRFRRYYRNNGRVSRAATAKKERIWPEGIIPFVI 66

  Fly    63 EDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLGYRNK-TQVVN 126
            ..: |:..|....|||:...|..:||.|.| .:......:..|....||.: ::|.|.: .|.::
 Worm    67 ASN-FSGEHQHLFLRAMRHWENFTCVSFVP-RQPHHKHYITFTVDKCGCCS-YVGRRGEGPQAIS 128

  Fly   127 LEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHD 191
                 :|:.|.:.|.::|||.||:||.|:|...:||.||.|.:|:|....:.||..:..... ..
 Worm   129 -----IGKNCDKFGIVVHELGHVVGFWHEHTRPDRDMYVDIFYKSIQTGQDYNFEKSKPEEV-DS 187

  Fly   192 FDEGYDYESVMHYVPRAFSRNG-QPTIVPLREGAENM--GQRFYMSEKDIRKLNKMYRCPD 249
            ..|.||:.|:|||....|||.. ..||:|.......:  |||..:||.|||:..|:|:|.:
 Worm   188 LGEPYDFSSIMHYARDTFSRGAFYDTILPKPNSGFRLEIGQRVQLSEGDIRQTKKLYKCAE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 65/199 (33%)
ZnMc_astacin_like 55..245 CDD:239807 61/193 (32%)
nas-39NP_001360030.1 ZnMc_BMP1_TLD 48..247 CDD:239808 64/207 (31%)
CUB 268..343 CDD:214483
CUB 359..474 CDD:238001
FXa_inhibition 480..515 CDD:373209
CUB 519..622 CDD:366096
FXa_inhibition 629..664 CDD:373209
CUB 669..780 CDD:238001
CUB 782..898 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.