DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and Adgrg6

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:117 Identity:24/117 - (20%)
Similarity:43/117 - (36%) Gaps:32/117 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DSHYREILRAISIIEENSCVIFKPAT----------EMDFPMALV--ITSKGLGCNTVHL--GYR 119
            |....::|..|:.|......||..||          ..|:|..::  ::|..|..|.:.|  |:.
  Rat   855 DGRNTKVLTFITYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSSALLFLNLIFLLDGWI 919

  Fly   120 NKTQVVNLEIYPLGEGCFRIGSIIHELLHV----LGFEHQHVSQNRDQYVSI 167
            ....|..|        |..:.:::|..|..    :|.|..|:      |:::
  Rat   920 TSFGVAGL--------CTAVAALLHFFLLATFTWMGLEAIHM------YIAL 957

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 24/117 (21%)
ZnMc_astacin_like 55..245 CDD:239807 24/117 (21%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001
LamG 178..337 CDD:304605
GPS 799..844 CDD:280071
7tm_4 861..1108 CDD:304433 23/111 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.