DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and Astl

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001099974.1 Gene:Astl / 296129 RGDID:1562279 Length:436 Species:Rattus norvegicus


Alignment Length:233 Identity:82/233 - (35%)
Similarity:120/233 - (51%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QGD-IKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYRE-----ILRAISIIEENSCVIF 90
            :|| |:..|.|..:...|:   || :.|..::|......|.|.|     |:.|.:..|..:|:.|
  Rat    75 EGDIIRPSPFRLLSVTNNK---WP-KGVDGIVEIPFLLSSKYDEPSRQVIMEAFAEFERFTCIRF 135

  Fly    91 KP-ATEMDF----PMALVITSKGLGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVL 150
            .. ..:.||    |||        ||.: .:|.....|||:|....|.:|   .|.::|||:|||
  Rat   136 VAYRGQRDFVSILPMA--------GCFS-GVGRSGGMQVVSLAPTCLQKG---RGIVLHELMHVL 188

  Fly   151 GFEHQHVSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQP 215
            ||.|:|...:||:|:.:.|..|.|.:.|||:.:.||    :....|||.|||||...|||..|||
  Rat   189 GFWHEHSRADRDRYIRVNWNEILPGFEINFIKSRNS----NMLAPYDYSSVMHYGRFAFSWRGQP 249

  Fly   216 TIVPLREGAENMGQRFYMSEKDIRKLNKMYRC----PD 249
            ||:||...:.::|||:.:|..||.::.::|.|    ||
  Rat   250 TIIPLWTSSVHIGQRWNLSTSDITRVCRLYSCSPSVPD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 74/209 (35%)
ZnMc_astacin_like 55..245 CDD:239807 70/199 (35%)
AstlNP_001099974.1 Astacin 92..283 CDD:279708 75/210 (36%)
ZnMc 99..281 CDD:294052 70/197 (36%)
ImpA_N <305..420 CDD:303075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.