DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and Tll2

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_036034.1 Gene:Tll2 / 24087 MGIID:1346044 Length:1012 Species:Mus musculus


Alignment Length:201 Identity:65/201 - (32%)
Similarity:105/201 - (52%) Gaps:15/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPATEMDFPMALVITSKGLGCNTVHLG 117
            ||...:||:|..: |..:......:|:...|:::||.|...|  |....:|.:.:..||.: ::|
Mouse   156 WPGGVIPYVIGGN-FTGTQRAIFKQAMRHWEKHTCVTFVERT--DEESFIVFSYRTCGCCS-YVG 216

  Fly   118 YR-NKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFV 181
            .| ...|.::     :|:.|.:.|.:.|||.||:||.|:|...:|||:|:|..:||.|....||:
Mouse   217 RRGGGPQAIS-----IGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFL 276

  Fly   182 NNDNSTAWHDFDEGYDYESVMHYVPRAFSRN-GQPTIVPLREG---AENMGQRFYMSEKDIRKLN 242
            ..:.... ....|.||::|:|||....|||. ...||:|.|:.   ...:|||..:|:.||.:..
Mouse   277 KMEAGEV-SSLGETYDFDSIMHYARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQAR 340

  Fly   243 KMYRCP 248
            |:|:||
Mouse   341 KLYKCP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 65/201 (32%)
ZnMc_astacin_like 55..245 CDD:239807 60/194 (31%)
Tll2NP_036034.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..135
ZnMc_BMP1_TLD 147..346 CDD:239808 63/199 (32%)
Astacin 154..347 CDD:279708 65/201 (32%)
CUB 348..457 CDD:278839
CUB 461..570 CDD:278839
FXa_inhibition 581..613 CDD:291342
CUB 617..726 CDD:278839
FXa_inhibition 733..768 CDD:291342
CUB 773..882 CDD:278839
CUB 886..999 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.