Sequence 1: | NP_609756.1 | Gene: | Semp1 / 34914 | FlyBaseID: | FBgn0028944 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033424.1 | Gene: | Tnfaip6 / 21930 | MGIID: | 1195266 | Length: | 275 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 40/206 - (19%) |
---|---|---|---|
Similarity: | 78/206 - (37%) | Gaps: | 45/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 KAHPIRTRNGIVNQ---------IYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFK 91
Fly 92 ---PATEMDFPMALV-----------ITSKGLGC-----NTVHLGYR-NKTQVVNLEIY-PLGEG 135
Fly 136 CFRIGSIIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINFVNND---NSTAWHDFDEGYD 197
Fly 198 -YESVMHYVPR 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Semp1 | NP_609756.1 | Astacin | 53..249 | CDD:279708 | 33/180 (18%) |
ZnMc_astacin_like | 55..245 | CDD:239807 | 33/178 (19%) | ||
Tnfaip6 | NP_033424.1 | Link_domain_TSG_6_like | 36..128 | CDD:239592 | 16/100 (16%) |
CUB | 135..244 | CDD:278839 | 17/76 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 253..275 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |