DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Semp1 and Adgrg6

DIOPT Version :9

Sequence 1:	NP_609756.1	Gene:	Semp1 / 34914	FlyBaseID:	FBgn0028944	Length:	251	Species:	Drosophila melanogaster
Sequence 2:	XP_006512741.1	Gene:	Adgrg6 / 215798	MGIID:	1916151	Length:	1258	Species:	Mus musculus

Alignment Length:	117	Identity:	24/117 - (20%)
Similarity:	43/117 - (36%)	Gaps:	32/117 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    69 DSHYREILRAISIIEENSCVIFKPAT----------EMDFPMALV--ITSKGLGCNTVHL--GYR 119
            |....::|..|:.|......||..||          ..|:|..::  ::|..|..|.:.|  |:.
Mouse   865 DGRNTKVLTFITYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSSALLFLNLIFLLDGWV 929

  Fly   120 NKTQVVNLEIYPLGEGCFRIGSIIHELLHV----LGFEHQHVSQNRDQYVSI 167
            ....|..|        |..:.:::|..|..    :|.|..|:      |:::
Mouse   930 TSFGVAGL--------CTAVAALLHFFLLATFTWMGLEAIHM------YIAL 967

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Semp1	NP_609756.1	Astacin	53..249	CDD:279708	24/117 (21%)
Semp1	NP_609756.1	ZnMc_astacin_like	55..245	CDD:239807	24/117 (21%)
Adgrg6	XP_006512741.1	CUB	48..156	CDD:238001
		LamG	188..347	CDD:389952
		HRM	543..588	CDD:382965
		GPS	809..854	CDD:366827
		7tm_GPCRs	869..1137	CDD:391938	23/113 (20%)
		TM helix 1	871..896	CDD:341315	7/24 (29%)
		TM helix 2	906..928	CDD:341315	4/21 (19%)
		TM helix 3	939..966	CDD:341315	6/32 (19%)
		TM helix 4	981..997	CDD:341315
		TM helix 5	1026..1049	CDD:341315
		TM helix 6	1072..1097	CDD:341315
		TM helix 7	1101..1126	CDD:341315
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900