DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and Astl

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001277932.1 Gene:Astl / 215095 MGIID:3046414 Length:435 Species:Mus musculus


Alignment Length:269 Identity:84/269 - (31%)
Similarity:130/269 - (48%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FTPTVFSELFKDPELLA--------------GFYQGD-IKAHPIRTRNGIVNQIYHWPNRT---- 57
            |||. .|.:|:|.::.|              ...:|| |:..|.|..:...|:   ||...    
Mouse    42 FTPE-GSPVFQDKDIPAINQGLISEETPESSFLVEGDIIRPSPFRLLSVTNNK---WPKGVGGFV 102

  Fly    58 -VPYMIEDDAFADSHYREILRAISIIEENSCVIFKP-ATEMDF----PMALVITSKGLGCNTVHL 116
             :|::: ...:.:...|.|:.|.:..|..:|:.|.. ..:.||    |||        ||.: .:
Mouse   103 EIPFLL-SRKYDELSRRVIMDAFAEFERFTCIRFVAYHGQRDFVSILPMA--------GCFS-GV 157

  Fly   117 GYRNKTQVVNLEIYPLGEGCFRIGS--IIHELLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNIN 179
            |.....|||:     |...|.|.|.  ::|||:|||||.|:|...:||:|:.:.|..|.|.:.||
Mouse   158 GRSGGMQVVS-----LAPTCLRKGRGIVLHELMHVLGFWHEHSRADRDRYIQVNWNEILPGFEIN 217

  Fly   180 FVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLREGAENMGQRFYMSEKDIRKLNKM 244
            |:.:.::    :....|||.|||||...|||..|||||:||...:.::|||:.:|..||.::.::
Mouse   218 FIKSRST----NMLVPYDYSSVMHYGRFAFSWRGQPTIIPLWTSSVHIGQRWNLSTSDITRVCRL 278

  Fly   245 YRC----PD 249
            |.|    ||
Mouse   279 YNCSRSVPD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 69/211 (33%)
ZnMc_astacin_like 55..245 CDD:239807 65/201 (32%)
AstlNP_001277932.1 Astacin 92..282 CDD:279708 69/211 (33%)
ZnMc 100..281 CDD:294052 66/199 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5777
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.