DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Semp1 and Y19D10A.6

DIOPT Version :9

Sequence 1:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_503652.3 Gene:Y19D10A.6 / 189484 WormBaseID:WBGene00021221 Length:272 Species:Caenorhabditis elegans


Alignment Length:235 Identity:60/235 - (25%)
Similarity:90/235 - (38%) Gaps:63/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PIRTRNGIVNQ-----IYHWPNRTVPYMIEDDAFADSHYRE-----ILRAISIIEENSCVIFKPA 93
            |:|.:.||...     .|.|||..|||.|.      :||..     ||.|:...:..:||.|:|.
 Worm    41 PLRKKRGIALHPLQWASYLWPNAEVPYDIA------THYTSTEKSIILSAMEAFKNVTCVRFRPR 99

  Fly    94 TEMD---------FPMALVITSKGLGCNTVHLGYRNKTQVVNLEI-YPLGEGCFR---IGSIIHE 145
            ...|         |.:....:..|...:....|    |...|:|. ..|...|.|   .|.::||
 Worm   100 AATDKHYLQINKYFNVERCFSYIGRQSSRTLFG----TPEGNVETRMRLDPACLRGNGRGIVMHE 160

  Fly   146 LLHVLGFEHQHVSQNRDQYVSIQWKNINPQYNINF-VNNDNSTAWHDFDEGYDYESVMHYVPRAF 209
            |:|:|||.|:|...:||:.:      :....:.|| :.....|.:..   .||..|:|||     
 Worm   161 LMHILGFYHEHQRDDRDRRI------VGSAVHYNFKIYRRAKTLYMG---AYDANSIMHY----- 211

  Fly   210 SRNGQPTIVPLREGAENM--GQRFYMSEKDIRKLNKMYRC 247
                         ..:|:  .:|.:.|..||..:|..|:|
 Worm   212 -------------NFQNLPWQRRDHFSTSDIININTFYKC 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Semp1NP_609756.1 Astacin 53..249 CDD:279708 55/216 (25%)
ZnMc_astacin_like 55..245 CDD:239807 51/210 (24%)
Y19D10A.6NP_503652.3 Astacin 58..240 CDD:279708 56/218 (26%)
ZnMc 62..236 CDD:294052 51/210 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.